Protein coding transcript 166518

• Transcript: Ll_transcript_128337
• CDS coordinates: 3-332 (+)
• Peptide sequence: FFFFFLSELHLGSIPTEMSTRDQKLLKKEQDVSFVLSRRSKNKEIVNIFKIIMYLQNTVSIHPISSDPGCDMVPKDELSRSNKILFLNKNPIDLLVLEGGSHWRASSRN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_128337

• Blastp: Protein Ycf2 from Gossypium with 86.81% of identity
• Blastx: Protein Ycf2 from Gossypium with 86.81% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (3989170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (YP_008963643.1)
• Pfam: Plant protein of unknown function (DUF825) (PF05695.11)
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;