Protein coding transcript 166558

• Transcript: Ll_transcript_128879
• CDS coordinates: 247-645 (+)
• Peptide sequence: MCFISTFIDLSQGMLFVESPRCKKRLQIRLELDANDGDIEDIELYGQRYKVYSYSNETNVWFSQAIGKPCTFLRYSSCDQDFLLNKTNGAAACRGAKSMLSFANEGQFLLVSEESVSDLNKRISSDVQKGIRG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_128879

• Blastp: Molybdenum cofactor sulfurase from Lycopersicon with 47.29% of identity
• Blastx: Molybdenum cofactor sulfurase from Lycopersicon with 52.26% of identity
• Eggnog: cysteine desulfurase(COG0520)
• Kegg: Link to kegg annotations (543832)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413651.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;