Protein coding transcript 166595

• Transcript: Ll_transcript_128913
• CDS coordinates: 247-660 (+)
• Peptide sequence: MCFISTFIDLSQGMLFVESPRCKKRLQIRLELDANDGDIEDIELYGQRYKVYSYSNETNVWFSQAIGKPCTFLRYSSCDQDFLLNKTNGAAACRGAKSMLSFANEGQFLLVSEESVSDLNKRISSGNTWNGNGSQCE*
• ORF Type: complete

Annotations of Ll_transcript_128913

• Blastp: Molybdenum cofactor sulfurase from Lycopersicon with 47.79% of identity
• Blastx: Molybdenum cofactor sulfurase from Lycopersicon with 52.8% of identity
• Eggnog: cysteine desulfurase(COG0520)
• Kegg: Link to kegg annotations (543832)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413647.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;