| Transcript | Ll_transcript_530995 |
|---|---|
| CDS coordinates | 41-418 (+) |
| Peptide sequence | MGVSSHPLLVSPTLKYIPKPTEENKSSSYEWNKVLVTQDTKQRSTKKSVKGRKQGKILRKKRTLLVEGSRRQAKEIQRRVRTLKRLIPNNQSMGLDGLYKETFDYILSLQMKVKAMQLMVQTLTG* |
| ORF Type | complete |
| Blastp | Transcription factor UPBEAT1 from Arabidopsis with 63.33% of identity |
|---|---|
| Blastx | Transcription factor UPBEAT1 from Arabidopsis with 63.33% of identity |
| Eggnog | Transcription factor(ENOG4111CN7) |
| Kegg | Link to kegg annotations (AT2G47270) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460512.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer