Transcript | Ll_transcript_127781 |
---|---|
CDS coordinates | 285-902 (+) |
Peptide sequence | MDLGVVGFDGLVGSDTVTSGHGFVSNASDPETKHKLYGSGGFLKQERSSTNVEDEWRSSKVAKTNDDGISGSSSKAMLFQHRNSLLRSCNNNNGTVFCDGQQQMLSFSSPKPETSSNATLHFSYQPCSRDAGYSSGSIMHGTITGSRGLFTPSQWMELEHQALIYKYITANVPVPSHLLIPIRKAIDSAGFYNFSTGLLRPNACM* |
ORF Type | complete |
Blastp | Growth-regulating factor 1 from Arabidopsis with 43.72% of identity |
---|---|
Blastx | Growth-regulating factor 1 from Arabidopsis with 45.24% of identity |
Eggnog | growth-regulating factor(ENOG4111S3M) |
Kegg | Link to kegg annotations (AT2G22840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436970.1) |
Pfam | QLQ (PF08880.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer