Transcript | Ll_transcript_129718 |
---|---|
CDS coordinates | 124-582 (+) |
Peptide sequence | MYSPESNIVRPCYKAKDHGLAFLTKKDFGHCTNNFVSRIITLGYGATSFVSSPRSGTRFYDARFEEQQPHFLQACFLCKKSLGENSDIFMYRGDTPFCSEKCREEQILIDEGKEKKKKLSSSMKAMRNREKTKSGSPNKAQGYSFRTGAVAA* |
ORF Type | complete |
Blastp | Protein MARD1 from Arabidopsis with 29.52% of identity |
---|---|
Blastx | Protein MARD1 from Arabidopsis with 29.52% of identity |
Eggnog | Protein of unknown function (DUF581)(ENOG41105YW) |
Kegg | Link to kegg annotations (AT3G63210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446010.1) |
Pfam | zinc-finger of the FCS-type, C2-C2 (PF04570.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer