Protein coding transcript 166658

• Transcript: Ll_transcript_129739
• CDS coordinates: 110-583 (+)
• Peptide sequence: MYSTESTCVRPCYLEKNHGLASLKDMDSVNCANNSFVSRSMMPMAMGYAAATSYVSSPRSGRRFYDARFEDHKPHFLQACFLCKKPLGDNSDIFMYRGDTPFCSEKCREEQILIDEGKEKKKKLSSSMKAMRNREKTKSGSPNKAQGYSFRTGAVAA*
• ORF Type: complete

Annotations of Ll_transcript_129739

• Blastp: Protein MARD1 from Arabidopsis with 48.78% of identity
• Blastx: Protein MARD1 from Arabidopsis with 48.78% of identity
• Eggnog: Protein of unknown function (DUF581)(ENOG41105YW)
• Kegg: Link to kegg annotations (AT3G63210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421783.1)
• Pfam: zinc-finger of the FCS-type, C2-C2 (PF04570.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;