Protein coding transcript 166758

• Transcript: Ll_transcript_129188
• CDS coordinates: 3-383 (-)
• Peptide sequence: AGAIDGIIRYISGCETKEKNLAPLAMNIIEKLMVLESAKEALVNNPNGVEILVKMVFKVCNQECSEGAVEVLLIICSDFRSAREEAIGAGVLTQLLFLLQSQCGTKTKTKARMLLKLLRSKWTEESK
• ORF Type: internal

Annotations of Ll_transcript_129188

• Blastp: U-box domain-containing protein 26 from Arabidopsis with 36.59% of identity
• Blastx: U-box domain-containing protein 26 from Arabidopsis with 36.59% of identity
• Eggnog: Ubox domain-containing protein(ENOG410YB5U)
• Kegg: Link to kegg annotations (AT1G49780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430174.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;