Protein coding transcript 166775

• Transcript: Ll_transcript_180590
• CDS coordinates: 572-898 (+)
• Peptide sequence: MQMISMRYGAIPIVRKTGGLNDSVFDVGDDTVPSQFQNGFTFLNADEPGINGALDRAFNLYMNNPEIWQQLVRKDMNMDFSWDTSAAQYEDIYSMSVARAKGYKKVIN*
• ORF Type: complete

Annotations of Ll_transcript_180590

• Blastp: Probable starch synthase 4, chloroplastic/amyloplastic from Arabidopsis with 65.35% of identity
• Blastx: Probable starch synthase 4, chloroplastic/amyloplastic from Arabidopsis with 53.38% of identity
• Eggnog: starch synthase activity(COG0297)
• Kegg: Link to kegg annotations (AT4G18240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434543.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;