Protein coding transcript 166784

• Transcript: Ll_transcript_180595
• CDS coordinates: 436-1143 (+)
• Peptide sequence: MLAALVNLWIENHQRHQAGLYFFVYPFFASMDLFGIYQGLKHVHLKTLTKDRLEIILNTWIECGYVPSPAEVSEKEGINMLGVKGKNSWPIRIGCLNSKDQIPKWSMKTIQFVTDEDYYFVCMEIFKGLKRTRQHRILLSMREGSETVHVITGLLQACYIRRTLLENSSKWEIIIEERNCSSSALSDWSEILEDSKRFAERDVPNLIDEMVRIGWVVKSILLSTQEQVRYSFVCD*
• ORF Type: complete

Annotations of Ll_transcript_180595

• Blastp: Protein root UVB sensitive 4 from Arabidopsis with 50.45% of identity
• Blastx: Protein root UVB sensitive 4 from Arabidopsis with 57.91% of identity
• Eggnog: Chromosome 16 open reading frame 58(ENOG410XU74)
• Kegg: Link to kegg annotations (AT2G23470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459139.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;