Transcript | Ll_transcript_180620 |
---|---|
CDS coordinates | 476-865 (+) |
Peptide sequence | MKTIQFVTDEDYYFVCMEIFKGLKRTRQHRILLSMREGSETVHVITGLLQACYIRRTLLENSSKWEIIIEERNCSSSALSDWSEILEDSKRFAERDVPNLIDEMVRIGWVVKSILLSTQEQVRYSFVCD* |
ORF Type | complete |
Blastp | Protein root UVB sensitive 4 from Arabidopsis with 39.37% of identity |
---|---|
Blastx | Protein root UVB sensitive 4 from Arabidopsis with 43.24% of identity |
Eggnog | Chromosome 16 open reading frame 58(ENOG410XU74) |
Kegg | Link to kegg annotations (AT2G23470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459139.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer