Protein coding transcript 166789

• Transcript: Ll_transcript_180598
• CDS coordinates: 2-727 (+)
• Peptide sequence: LGRVPVFPIFLFIHLSLFYSSLFLAPNSLFHYFKSLFFFIYCSLPQTISQKLLQFSLSILSRSNFSHMPLFSLLHTPTWNFQWGTYPLPKQPIPINQNLFLRKVSPFSLKTPTSLDSVSSSNDGGGRVEEKGSKILPFIVKGPTKVSRYLWDGEGLKIVTVGDGADGVSSSDNGFCRFCCTIVRDFFIPRYVRDDYLDYVKWKLLHRVFSSALQVLATQVLLQIFSLCFWCNLSRFIGWVS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_180598

• Blastp: Protein root UVB sensitive 4 from Arabidopsis with 44.12% of identity
• Blastx: Protein root UVB sensitive 4 from Arabidopsis with 43.02% of identity
• Eggnog: Chromosome 16 open reading frame 58(ENOG410XU74)
• Kegg: Link to kegg annotations (AT2G23470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459138.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;