Protein coding transcript 166790

• Transcript: Ll_transcript_180602
• CDS coordinates: 232-543 (+)
• Peptide sequence: MCLMIDMLPHACKFDVVTLFKQSSVHQSFAIIDNLGEISAKAQIQTVCFDILGLMLAALVNLWIENHQRHQAGLYFFVYPFFASMDLFGIYQGLKHVHLKTLTK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_180602

• Blastp: Protein root UVB sensitive 4 from Arabidopsis with 65.85% of identity
• Blastx: Protein root UVB sensitive 4 from Arabidopsis with 65.85% of identity
• Eggnog: Chromosome 16 open reading frame 58(ENOG410XU74)
• Kegg: Link to kegg annotations (AT2G23470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459139.1)
• Pfam: Vitamin B6 photo-protection and homoeostasis (PF04884.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;