| Transcript | Ll_transcript_530960 |
|---|---|
| CDS coordinates | 2-310 (+) |
| Peptide sequence | PHNHSNMALRLATRRFAPSFAPQMLRRSMATTIEHTKGEPISTAAEAMTASRPPVPETKTTTVKEPSLDPEALTKTFHVYRWNPDEPTSKPKMQSYTLDLNKT |
| ORF Type | internal |
| Blastp | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial from Zymoseptoria with 74.23% of identity |
|---|---|
| Blastx | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial from Zymoseptoria with 74.23% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447431.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer