Protein coding transcript 166806

• Transcript: Ll_transcript_181341
• CDS coordinates: 2-550 (+)
• Peptide sequence: FFPLNIFSLCFGTMSDQIHNTCPFTLLSSSSSSSFRLQSIFNMFDKNGDAIITVEEISQALNLLGLDAEIKDIESLMKSYIKREKEGLMYKDFMEFVWDTLLLDSEQQESELCEAFKVFDEDGDGYISAQELQVVLRKLELIEGNEIDSVQNMICCVDQNHDGRVDFFEFKDMFRTTFVTTS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_181341

• Blastp: Calcium-binding protein CAST from Solanum with 55.83% of identity
• Blastx: Calcium-binding protein CAST from Solanum with 55% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427314.1)
• Pfam: EF-hand domain (PF13405.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;