Protein coding transcript 166884

• Transcript: Ll_transcript_181633
• CDS coordinates: 2-313 (+)
• Peptide sequence: QWLSEIDRYASDNVNKLLVGNKSDLTANRVVSYDTAKEFADEIGIPFMETSAKDSTNVEQAFMAMSASIKNRMASQPSANNGRPPTVQIKGQPVGQKSGCCSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_181633

• Blastp: Ras-related protein RABD2a from Arabidopsis with 85.44% of identity
• Blastx: Ras-related protein RABD2a from Arabidopsis with 86.6% of identity
• Eggnog: member RAS oncogene family(ENOG410XQN5)
• Kegg: Link to kegg annotations (AT1G02130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463953.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;