Transcript | Ll_transcript_182607 |
---|---|
CDS coordinates | 1-741 (+) |
Peptide sequence | WFINLSASDYPLVTQDDLLYTFSDLDRSINFIEHTSYLGWKLDKRAMPLIIDPGLYMSNKSDVFSVGPKRTLPTAFKLFTGSAWMVLSRAFVEYVIWGWDNLPRTLLMYYTNFISSPEDYFQTVVCNSPKLAKTVVNNDLHYISWDNPPKQHPHVLGINDTEKMIASSAAFARKFKQDDPVLDVIDKNLLHRQKGLLTPGGWCSGKPRCSKVGNIYKIKPGPGSQRLRLLVARLTLKSRFGQNQCK* |
ORF Type | 5prime_partial |
Blastp | Beta-glucuronosyltransferase GlcAT14A from Arabidopsis with 62.15% of identity |
---|---|
Blastx | Beta-glucuronosyltransferase GlcAT14A from Arabidopsis with 62.15% of identity |
Eggnog | Glucosaminyl (N-acetyl) transferase(ENOG410XQ7M) |
Kegg | Link to kegg annotations (AT5G39990) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449163.1) |
Pfam | Core-2/I-Branching enzyme (PF02485.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer