Protein coding transcript 1669

• Transcript: Ll_transcript_531047
• CDS coordinates: 2-346 (+)
• Peptide sequence: DPASMEGYQKGTFDLGKWLQSHSPQEVALPLVDKVQDALTADGVKRFGCVSFCYGGRVAVDKVLNGSLDVAVTAHPSLLEVPKDIEALNGKSVPFLFNNASEDVMFNKEQQEKSA
• ORF Type: internal

Annotations of Ll_transcript_531047

• Blastp: Hydrolase tropI from Talaromyces with 31.25% of identity
• Blastx: Hydrolase tropI from Talaromyces with 31.25% of identity
• Eggnog: dienelactone hydrolase(COG0412)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439773.1)
• Pfam: Dienelactone hydrolase family (PF01738.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;