Protein coding transcript 16692

• Transcript: Ll_transcript_276494
• CDS coordinates: 229-606 (+)
• Peptide sequence: MKSFTPFLCFLLFLLSIQFESSLGSKRTDVAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLVSDGVSDFANNLLQADGWIVEKISLLENPNQVRPKRFWGVYTKLKIFNMTDYKKGKIFMFL*
• ORF Type: complete

Annotations of Ll_transcript_276494

• Blastp: Inositol phosphorylceramide glucuronosyltransferase 1 from Arabidopsis with 77.19% of identity
• Blastx: Inositol phosphorylceramide glucuronosyltransferase 1 from Arabidopsis with 81.55% of identity
• Eggnog: Glycosyl Transferase(COG5597)
• Kegg: Link to kegg annotations (AT5G18480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439927.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;