Transcript | Ll_transcript_181445 |
---|---|
CDS coordinates | 195-668 (+) |
Peptide sequence | MALESCEGGELFDQITRKSRLTEAEARFYAAEVVDALEYIHHLGLIHRDIKPENLLLTAEGHIKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDASEWLIFQRIIARDIRFPDYLS |
ORF Type | 3prime_partial |
Blastp | 3-phosphoinositide-dependent protein kinase 1 from Arabidopsis with 92.41% of identity |
---|---|
Blastx | 3-phosphoinositide-dependent protein kinase 1 from Arabidopsis with 92.41% of identity |
Eggnog | 3phosphoinositidedependent protein kinase(ENOG410XRT8) |
Kegg | Link to kegg annotations (AT5G04510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440990.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer