Protein coding transcript 166964

• Transcript: Ll_transcript_181445
• CDS coordinates: 195-668 (+)
• Peptide sequence: MALESCEGGELFDQITRKSRLTEAEARFYAAEVVDALEYIHHLGLIHRDIKPENLLLTAEGHIKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDASEWLIFQRIIARDIRFPDYLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_181445

• Blastp: 3-phosphoinositide-dependent protein kinase 1 from Arabidopsis with 92.41% of identity
• Blastx: 3-phosphoinositide-dependent protein kinase 1 from Arabidopsis with 92.41% of identity
• Eggnog: 3phosphoinositidedependent protein kinase(ENOG410XRT8)
• Kegg: Link to kegg annotations (AT5G04510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440990.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;