Protein coding transcript 16699

• Transcript: Ll_transcript_276406
• CDS coordinates: 1697-2065 (+)
• Peptide sequence: MDMKEKKLTVIGTVDPVNVVSKLRKYWHTDIIAVGPAKEPEKKEESKKEEPKKVEEKKEETKKEEGKKEEKKEEKKEDEKKKEPAPDPVLELVKAYRAYNPHMTTHYYVQSMEENPNACAIC*
• ORF Type: complete

Annotations of Ll_transcript_276406

• Blastp: Heavy metal-associated isoprenylated plant protein 39 from Arabidopsis with 55.56% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 39 from Arabidopsis with 84.09% of identity
• Eggnog: heavy metal transport detoxification protein(COG2608)
• Kegg: Link to kegg annotations (AT1G01490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454649.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;