Transcript | Ll_transcript_180421 |
---|---|
CDS coordinates | 1814-2170 (+) |
Peptide sequence | MQALMNFMRKSTDGFSIGSILLDFSGGIFNFSQMVVQSIDQGSWMNFCGNIGKVMISLVTIFYDSILMFQHYVLYPDNKGVITSKIYEEIKQPLNSATQIDEQINGSVKSSDLSSAEV* |
ORF Type | complete |
Blastp | Cystinosin homolog from Arabidopsis with 60.22% of identity |
---|---|
Blastx | Cystinosin homolog from Arabidopsis with 57.14% of identity |
Eggnog | cystinosin(ENOG410XQSD) |
Kegg | Link to kegg annotations (AT5G40670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427034.1) |
Pfam | PQ loop repeat (PF04193.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer