| Transcript | Ll_transcript_180422 |
|---|---|
| CDS coordinates | 65-421 (+) |
| Peptide sequence | MASWNSFPLEVTYQVLGWLAFLSWAICGYPQIILNFHRKSVVGLNLDYEILNMVKLWSYLIYNVSLFFSSDIQKQYFDKYGYGQVCSLSIHCGYGHDCGNDCSYCDCGCCDADFGHCSA |
| ORF Type | 3prime_partial |
| Blastp | Cystinosin homolog from Arabidopsis with 59.55% of identity |
|---|---|
| Blastx | Cystinosin homolog from Arabidopsis with 59.55% of identity |
| Eggnog | cystinosin(ENOG410XQSD) |
| Kegg | Link to kegg annotations (AT5G40670) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427033.1) |
| Pfam | PQ loop repeat (PF04193.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer