Protein coding transcript 167111

• Transcript: Ll_transcript_180429
• CDS coordinates: 186-686 (+)
• Peptide sequence: MRSPVISSPFNLRTEERAARRQKKLEEKFNAYEAQKVQQHTKVKEKKDTEIMSKLRRSFCFKARPLPDFYKERKASKDETKKDTLPHSESLKEGRKNTPRHNVVESKVSLPLNKPSLRYNVNKKFHGNSSDTMIHPMTSYSRMITTHENTSPNILHENQNDRNYKY*
• ORF Type: complete

Annotations of Ll_transcript_180429

• Blastp: Protein WVD2-like 4 from Arabidopsis with 49.33% of identity
• Blastx: Protein WVD2-like 4 from Arabidopsis with 47.83% of identity
• Eggnog: lymphoid organ expressed yellow head virus receptor protein(ENOG410YUCH)
• Kegg: Link to kegg annotations (AT2G35880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451154.1)
• Pfam: Targeting protein for Xklp2 (TPX2) (PF06886.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;