Protein coding transcript 167137

• Transcript: Ll_transcript_180354
• CDS coordinates: 643-1404 (+)
• Peptide sequence: MGKPLFYEIWEKPATSCIIGICSAIWFYIQKKNIGYSHVGLSYETAIEGHYWRIITSAFSHISAIHLVFNMSALWSLGVVEQLDHMGLGVGYYLQYTFVMVVSSGMLVLAMYHLLIQRFKIEYFRRVTAVGYSCVVFGWMTILSMKQPSSNLELFGFLSLPISFVPFESLIFTSIVVPRASFIGHLSGIIVGYAIAWGLIHGMNSYWALSLLGWVALVFVWSLKKSGAVDLSFLEIESVTEPSLPVWFLASGNG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_180354

• Blastp: RHOMBOID-like protein 13 from Arabidopsis with 77.56% of identity
• Blastx: RHOMBOID-like protein 13 from Arabidopsis with 77.56% of identity
• Eggnog: Rhomboid domain containing(ENOG41100KJ)
• Kegg: Link to kegg annotations (AT3G59520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413063.1)
• Pfam: Rhomboid family (PF01694.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;