Transcript | Ll_transcript_531002 |
---|---|
CDS coordinates | 2-355 (+) |
Peptide sequence | LRVLAHKAPEDSMPQLGFVSHTDKSFTTILHQNHVNALMVETKDGNWIDVDFSSPASFVVMAGDALMVWSNDRIKSPIHKVVMNGNETRYSLGLFAFYKGILEVPEELIDDEHPLQYK |
ORF Type | internal |
Blastp | Probable 2-oxoglutarate-dependent dioxygenase AOP1 from Arabidopsis with 50.94% of identity |
---|---|
Blastx | Probable 2-oxoglutarate-dependent dioxygenase AOP1 from Arabidopsis with 50.94% of identity |
Eggnog | 2OGFe(II) oxygenase(COG3491) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426947.1) |
Pfam | 2OG-Fe(II) oxygenase superfamily (PF03171.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer