Protein coding transcript 1672

• Transcript: Ll_transcript_531002
• CDS coordinates: 2-355 (+)
• Peptide sequence: LRVLAHKAPEDSMPQLGFVSHTDKSFTTILHQNHVNALMVETKDGNWIDVDFSSPASFVVMAGDALMVWSNDRIKSPIHKVVMNGNETRYSLGLFAFYKGILEVPEELIDDEHPLQYK
• ORF Type: internal

Annotations of Ll_transcript_531002

• Blastp: Probable 2-oxoglutarate-dependent dioxygenase AOP1 from Arabidopsis with 50.94% of identity
• Blastx: Probable 2-oxoglutarate-dependent dioxygenase AOP1 from Arabidopsis with 50.94% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426947.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;