Protein coding transcript 167200

• Transcript: Ll_transcript_181236
• CDS coordinates: 854-1513 (+)
• Peptide sequence: MDIHVGQSYSFLVTMDQNASTDYYIVASPRFVNSSWARATGVAILHYSNSQGPASGPLPSLSDQDDPYFSMNQARSIRWNVSAGAARPNPQGSFRYSDITVTDVYVILNRPPELIKGKWRTTLNGISYLPPSTPLKLAEQFKILGVYKLDFPNKLMNRPPKVDTSLINGTYRGFMEIIFQNNDTTVQTYHMDGYAFFVVGYDFKFKLTFIFSSSMRLYN*
• ORF Type: complete

Annotations of Ll_transcript_181236

• Blastp: Monocopper oxidase-like protein SKU5 from Arabidopsis with 67.8% of identity
• Blastx: Monocopper oxidase-like protein SKU5 from Arabidopsis with 69.27% of identity
• Eggnog: Multicopper oxidase(COG2132)
• Kegg: Link to kegg annotations (AT4G12420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461477.1)
• Pfam: Multicopper oxidase (PF00394.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;