Protein coding transcript 167223

• Transcript: Ll_transcript_181087
• CDS coordinates: 69-605 (+)
• Peptide sequence: MAMIYMKPFFLPLIVFFTTIFLMQLNRVNSSDALSFSYNDFDLDEKNLIFQGDAHITPGNVLQLTKTDSKGAPQRNTVGRVLFSSPMRLYIKGADRVSDFESNINFVLTKPSTRPADGLAFFIAPTGSTIPKHSKGGYLGLFDETAAFDSTANPVVAVEFDTYHNPWDPMYAHIGINVN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_181087

• Blastp: Agglutinin-2 from Cladrastis with 52% of identity
• Blastx: Agglutinin-2 from Cladrastis with 52% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429743.1)
• Pfam: Legume lectin domain (PF00139.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;