Transcript | Ll_transcript_181087 |
---|---|
CDS coordinates | 69-605 (+) |
Peptide sequence | MAMIYMKPFFLPLIVFFTTIFLMQLNRVNSSDALSFSYNDFDLDEKNLIFQGDAHITPGNVLQLTKTDSKGAPQRNTVGRVLFSSPMRLYIKGADRVSDFESNINFVLTKPSTRPADGLAFFIAPTGSTIPKHSKGGYLGLFDETAAFDSTANPVVAVEFDTYHNPWDPMYAHIGINVN |
ORF Type | 3prime_partial |
Blastp | Agglutinin-2 from Cladrastis with 52% of identity |
---|---|
Blastx | Agglutinin-2 from Cladrastis with 52% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429743.1) |
Pfam | Legume lectin domain (PF00139.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer