Protein coding transcript 167292

• Transcript: Ll_transcript_180900
• CDS coordinates: 3-308 (+)
• Peptide sequence: FGVLLVEAITGRDPVDYSRPAAEVNLVDWLKIMVGSRRAEEVVDTNIETRPSTSSLKRAILTALRCVDPYSEKRPKMSQVVRMLQSEEYPVPREVSLLILI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_180900

• Blastp: Probable receptor-like protein kinase At2g42960 from Arabidopsis with 73.4% of identity
• Blastx: Probable receptor-like protein kinase At5g18500 from Arabidopsis with 74.47% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G42960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455736.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;