Protein coding transcript 167293

• Transcript: Ll_transcript_180902
• CDS coordinates: 3-386 (+)
• Peptide sequence: FGVLLVEAITGRDPVDYSRPAAEVNLVDWLKIMVGSRRAEEVVDTNIETRPSTSSLKRAILTALRCVDPYSEKRPKMSQVVRMLQSEEYPVPREDRRRRKSQAESIEMEAQKETPESKFNGRRKQGK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_180902

• Blastp: Probable receptor-like protein kinase At5g18500 from Arabidopsis with 75.49% of identity
• Blastx: Probable receptor-like protein kinase At2g42960 from Arabidopsis with 65.49% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G18500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455736.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;