Transcript | Ll_transcript_181376 |
---|---|
CDS coordinates | 219-593 (+) |
Peptide sequence | MNNLDNDDFIKQMLSSSLDQTSILPFPSSYHQHPSNKPLMLNQHFLMSSHFGSSQNDVVHSSSFNSPIHGASNHDTQHFQQSHGGSNQMQAPTGATLAQPKQRVRARRGQATDPHSIAERARFS* |
ORF Type | complete |
Blastp | Transcription factor bHLH69 from Arabidopsis with 58.49% of identity |
---|---|
Blastx | Transcription factor bHLH69 from Arabidopsis with 58.49% of identity |
Eggnog | Helix-loop-helix DNA-binding domain(ENOG4111CIP) |
Kegg | Link to kegg annotations (AT4G30980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463399.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer