Protein coding transcript 167350

• Transcript: Ll_transcript_181386
• CDS coordinates: 1-345 (+)
• Peptide sequence: PIIMDSKPWIILVLLAFSMMLASQASTIHEFGREMVTPGDIDLITDDNEFLMSSEIARRTLRGRRRYIGYNSMRANQVPCGQRGRSYYNCQQRGRANPYRRGCTKITNCARNVN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_181386

• Blastp: Protein RALF-like 4 from Arabidopsis with 42.59% of identity
• Blastx: Protein RALF-like 4 from Arabidopsis with 42.59% of identity
• Eggnog: hormone activity(ENOG410ZNB7)
• Kegg: Link to kegg annotations (AT1G28270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440241.1)
• Pfam: Rapid ALkalinization Factor (RALF) (PF05498.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;