Protein coding transcript 167353

• Transcript: Ll_transcript_181401
• CDS coordinates: 2638-3327 (+)
• Peptide sequence: MAFRGKQMMNKVLKKVGEKNLAPRVKESLEKYIPQSKVIMGRAKRGLFAGRHIQFGNNVSEDGGNKTRRTWKPNVQEKRLFSYALDKHIRIKVTTHALRCIDKAGGIDEYLIKTPYHKMDTELGLFWKAKIEKLYEELGNKEVVFFSPEDEAKFEQGFKDLKLSEKEARKEIRRKMYVGMSKNNVIEEEHKDDDQSKIEEEKSHDAPKLVPVSYVIAADKLKVGSVVSN*
• ORF Type: complete

Annotations of Ll_transcript_181401

• Blastp: 54S ribosomal protein L24, mitochondrial from Saccharomyces with 48% of identity
• Blastx: Nucleotide-sugar uncharacterized transporter 2 from Arabidopsis with 73.57% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YMR193W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456039.1)
• Pfam: Ribosomal L28 family (PF00830.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;