Protein coding transcript 167365

• Transcript: Ll_transcript_181398
• CDS coordinates: 1863-2795 (+)
• Peptide sequence: MLCNHFLHSPISILSPSPSPSPSSRSKLKLFVSNSAMDDGGSSKFKEFPFVSNPHKNLMLDLVSTLENRFHSHLLPSTLPSHVQYYQNPTATAQASLHIRSAHAHSPIDFILGSWVHSELPTGGSLDITSISGYLNSSNDAPNFVFEMIRSSPTMLVLILDLPPRKDLVLWPDDLKTFYEDTQLDKHRKALEALPEVQPYFSSSLYIRTVASPTAIMVRIQTQNDGGERMEEIIRDHLDPISKQVLSIWLDHCACAKREVGEAERAYLKKRDGIIRNKTIEIDLGSSFPRLFGSEVANRVLEVIKEYFSV*
• ORF Type: complete

Annotations of Ll_transcript_181398

• Blastp: Red chlorophyll catabolite reductase, chloroplastic from Arabidopsis with 54.77% of identity
• Blastx: Nucleotide-sugar uncharacterized transporter 2 from Arabidopsis with 61.36% of identity
• Eggnog: red chlorophyll catabolite reductase(ENOG4111JQP)
• Kegg: Link to kegg annotations (AT4G37000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456047.1)
• Pfam: Red chlorophyll catabolite reductase (RCC reductase) (PF06405.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;