Protein coding transcript 167377

• Transcript: Ll_transcript_181035
• CDS coordinates: 499-870 (+)
• Peptide sequence: MVLSLVLDIMDFQEVVLMTSYHGQRNPGLGILWRRSTQVNAILNTNHASAAGQRLYVTMFPCNECAKIIIQSGVSEVIYFVEKRLENSDIAYIASHKLLSLAGVKVRKHQPLMNEIRLKFEER*
• ORF Type: complete

Annotations of Ll_transcript_181035

• Blastp: Probable deoxycytidylate deaminase from Sophophora with 45.24% of identity
• Blastx: Deoxycytidylate deaminase from Pongo with 58.75% of identity
• Eggnog: dCMP deaminase activity(COG2131)
• Kegg: Link to kegg annotations (Dmel_CG6951)
• CantataDB: Link to cantataDB annotations (CNT0000426)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463479.1)
• Pfam: Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;