Protein coding transcript 167393

• Transcript: Ll_transcript_181062
• CDS coordinates: 215-586 (+)
• Peptide sequence: MIMEFMGPTRLIGDYIVGPKIGSGSFAIVYHSTHRHSGLEYAIKEIHNKNLSPKVKECLFKEISILSTIHHPNIIRLFQTIQTNDRIYLVLEYCGGGDLAAYIRRHGKVSEATARHFMRQLGD*
• ORF Type: complete

Annotations of Ll_transcript_181062

• Blastp: Serine/threonine-protein kinase ATG1a from Arabidopsis with 68.38% of identity
• Blastx: Serine/threonine-protein kinase ATG1a from Arabidopsis with 68.38% of identity
• Eggnog: Unc51-like kinase(ENOG410XR01)
• Kegg: Link to kegg annotations (AT3G61960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418707.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;