Protein coding transcript 16740

• Transcript: Ll_transcript_276473
• CDS coordinates: 39-1385 (+)
• Peptide sequence: MLTNQQKEKLSQMEGVVSVFPNRIIQLQTTRSWDFLGLPKSVKRSPSIESDVVVGVIDSGIWPESDSFNDQGFGPIPKNWKGVCAGGTNFTCNKKIIGARYYTDKSARDLDGHGTHTASTTAGNYIDNASLDGLAQGTARGGVPLARIAAYKACNEVGCGSAAILSAFDDAIADGVNIISVSLGGPTEQPFDQDPIAIGSFHAMARGILTVNGAGNGGPRPSTISCVAPWILTVGASTIDRRFIDKVLLGNGKTLTGSSINSFTLNGTQILIAKKNYGSKSECSEQRSSVCSCLDSSVVDGKIILCDTFDGIDVIDYDQGHPIGIIIQYHGKGSLDFVTPLPSLALSESEFKLLNSYINSTDNPTAEILKSEIVTDNNAPIVADFSSRGPNKLVPEILKPDISAPGVDILASFSQAVSPSRKKSDKRSAKYSIISGTSMACPHVSGIAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276473

• Blastp: Subtilisin-like protease SBT4.13 from Arabidopsis with 54.62% of identity
• Blastx: Subtilisin-like protease SBT4.13 from Arabidopsis with 54.41% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT5G59120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465245.1)
• Pfam: Peptidase inhibitor I9 (PF05922.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;