Protein coding transcript 167466

• Transcript: Ll_transcript_182048
• CDS coordinates: 1535-2440 (+)
• Peptide sequence: MADGQESDKNIEIWKIKKLIKALESARGNGTSMISLIMPPRDQVSRVTKMLGDEFGTASNIKSRVNRQSVLGAITSAQQRLKLYNKVPPNGLVLYTGTIVTDDGKEKKVTIDFEPFKPINASLYLCDNKFHTEALNELLESDDKFGFIIMDGNGTLFGTLSGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFYINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKRLIGKYFEEISQDTGKY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_182048

• Blastp: Eukaryotic peptide chain release factor subunit 1-3 from Arabidopsis with 96.03% of identity
• Blastx: Eukaryotic peptide chain release factor subunit 1-3 from Arabidopsis with 96.03% of identity
• Eggnog: Peptide Chain Release Factor(COG1503)
• Kegg: Link to kegg annotations (AT3G26618)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427587.1)
• Pfam: eRF1 domain 1 (PF03463.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;