Protein coding transcript 167485

• Transcript: Ll_transcript_180459
• CDS coordinates: 46-627 (+)
• Peptide sequence: MQIQWCSGMRFKMPFETEDSSRISWFMGTISSVQVADPIHWPDSPWRLLQVVWDEPDLLQNVMCVNPWLVELVTNMPTFHLSPFSPPRKKQRLLQDPEFHLNNQLPMPSFSSNLLNHHTNSLHNIQDHSSSSIQGARHAQFGLTPSVFPLNNNKQLQPEMHLFGFQRLNHAEKPVRPPCGIYKSSTKNNVDISC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_180459

• Blastp: Auxin response factor 18 from Oryza sativa with 55.15% of identity
• Blastx: Auxin response factor 18 from Oryza sativa with 56.94% of identity
• Eggnog: auxin response factor(ENOG410ZZ2C)
• Kegg: Link to kegg annotations (4341882)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452743.1)
• Pfam: Auxin response factor (PF06507.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;