Transcript | Ll_transcript_180470 |
---|---|
CDS coordinates | 626-1066 (+) |
Peptide sequence | MFQVVWDEPDLLQNVMCVNPWLVELVTNMPTFHLSPFSPPRKKQRLLQDPEFHLNNQLPMPSFSSNLLNHHTNSLHNIQDHSSSSIQGARHAQFGLTPSVFPLNNNKQLQPEMHLFGFQRLNHAEKPVRPPCGIYKSSTKNNVDISC |
ORF Type | 3prime_partial |
Blastp | Auxin response factor 18 from Oryza sativa with 45.58% of identity |
---|---|
Blastx | Auxin response factor 10 from Arabidopsis with 81.82% of identity |
Eggnog | auxin response factor(ENOG410ZZ2C) |
Kegg | Link to kegg annotations (4341882) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452743.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer