Protein coding transcript 16751

• Transcript: Ll_transcript_276894
• CDS coordinates: 99-1067 (+)
• Peptide sequence: MSEPPSEPPYWCYHCDKRVSTETLPNLTDVICGDCKNGFVELIPPPPTAPDNPSLSPSDSDDPYFASHFLHLLHLIAHSARDDDASPPPPPSRSPDNDFLRIELGGLDDDDDDEDEDEDGGEEEHEDRIDNVDLPGDDEDLSRRRREVLRLRIRDLASRTRSMRNRILDWPGVLTGMEDNSIEFRLQVPEPDRYVGNPEDYVDAAEFDALLQTLAETDGGGKRGAPPAAKSAVEALPTVEIMAEKEAVACAICKDVVGVGGVAKRLPCGHQYHGDCIVPWLGSRNSCPVCRFELPTDDKEYEQQRKNKRVMSSSSDGASGSG*
• ORF Type: complete

Annotations of Ll_transcript_276894

• Blastp: E3 ubiquitin-protein ligase CIP8 from Arabidopsis with 50.15% of identity
• Blastx: E3 ubiquitin-protein ligase CIP8 from Arabidopsis with 47.55% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G64920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441674.1)
• Pfam: zinc-ribbon (PF14369.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;