| Transcript | Ll_transcript_182368 |
|---|---|
| CDS coordinates | 3-326 (+) |
| Peptide sequence | NDMLWKLSLPVGVNRDHEYCNPMVRDGLEGLEKIKRLKWWVLVTGCSGDPLVDRQIELVKLMKKKRVRVVGHFTRGDYHGVQDKEPLKAKQLYGVMKSFILELPSQD* |
| ORF Type | 5prime_partial |
| Blastp | Carboxylesterase 1 from Actinidia with 48.04% of identity |
|---|---|
| Blastx | Carboxylesterase 1 from Actinidia with 48.04% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019432808.1) |
| Pfam | alpha/beta hydrolase fold (PF07859.12) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer