Transcript | Ll_transcript_182369 |
---|---|
CDS coordinates | 1-414 (+) |
Peptide sequence | LHSFETEFFERKKIWKKMTGSSEEGHVIGCHTLEAWNQQLQRGNESKKIIVVDFTASWCGPCRFIAPFLAELAKKFTDVIFLKVDVDELKSVAQDWAVEAMPTFVFIKEGTIVGKVVGAKKDELQQTLEKHVAAAGA* |
ORF Type | 5prime_partial |
Blastp | Thioredoxin H-type from Ricinus with 76.52% of identity |
---|---|
Blastx | Thioredoxin H-type from Ricinus with 76.52% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (8266412) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421225.1) |
Pfam | Thioredoxin (PF00085.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer