Protein coding transcript 167523

• Transcript: Ll_transcript_182370
• CDS coordinates: 1-450 (+)
• Peptide sequence: LHSFETEFFERKKIWKKMTGSSEEGHVIGCHTLEAWNQQLQRGNESKKIIVVDFTASWCGPCRFIAPFLAELAKKFTDVIFLKVDVDELKSVAQDWAVEAMPTFVFIKEGTIVGKVVGAKKDELQQTLEKHVAAAGNYYAWFTRVVGYSP
• ORF Type: internal

Annotations of Ll_transcript_182370

• Blastp: Thioredoxin H-type from Ricinus with 75.21% of identity
• Blastx: Thioredoxin H-type from Ricinus with 75.21% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8266412)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421225.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;