Protein coding transcript 167524

• Transcript: Ll_transcript_182374
• CDS coordinates: 76-432 (+)
• Peptide sequence: MAGSSEEGQVIGCHTVEAWNQQLQRGNESKQIIVVDFTASWCGPCRFIAPFLTELAKKYPNVIFLKVDVDELKSVAQDWAVEAMPTFMFIKEGSIVGKVVGAKKDELQQTLEKHLASA*
• ORF Type: complete

Annotations of Ll_transcript_182374

• Blastp: Thioredoxin H-type from Ricinus with 80% of identity
• Blastx: Thioredoxin H-type from Ricinus with 80% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8266412)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423645.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;