Protein coding transcript 1676

• Transcript: Ll_transcript_530978
• CDS coordinates: 3-410 (+)
• Peptide sequence: AFFMRSSFFEQGFLDEQFIQLEELQDEVNPNFVEEIVILFYSDSVRLIYKIEQALMSKPTNFAKLDDYMHQFKGSCSSIGAKKVKNECNIFNEYCAAENSEGCFRTFQQIKQEYTILKKKLETYFQLAREAAKNK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_530978

• Blastp: Pseudo histidine-containing phosphotransfer protein 5 from Oryza sativa with 54.55% of identity
• Blastx: Pseudo histidine-containing phosphotransfer protein 5 from Oryza sativa with 54.55% of identity
• Eggnog: Histidine kinase(COG2198)
• Kegg: Link to kegg annotations (107278650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416797.1)
• Pfam: Hpt domain (PF01627.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;