Protein coding transcript 167607

• Transcript: Ll_transcript_181152
• CDS coordinates: 531-1946 (+)
• Peptide sequence: MGLLVDAKLSSSLVFLLLNLLLVCSVNGIGVNWGTQATHPLSPSKVVKLMKDNGIQKVKLFDADPGILSALKKSGLQVMVGIPNDMLFTLANSLQAAEKWVSKNVSAHVSSGGVDIRYVAVGNEPFLSTYNGTFESTTLPALQNIQSALVKSGLGNKVKVTVPMNADVYLSASDKPSDGDFRPDIHDLMLQIVKFLSQNNAPFTVNIYPFISLYSDANFPVEFAFFNGFQSPINDNGRIYDNVLDANHDTLVWALQKNGFGNLPIIVGEIGWPTDGDHNANVQYAQRFNQGFMSRFIAGKGTPMRPGPIDAYLFSLIDEDDKSIQPGNFERHWGLFYYDGKPKYPLNLGTRTNNLVGASGVAYLPKKWCILKPSANLNSDQVAPSVSYACQNADCTSLGYGTSCGGLDVRGNLSYAFNSYYQVNDQMDSACKFPGLSVVTDKDPSTPSCKFIIMIQTDSAQLIRNRRRIWFL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_181152

• Blastp: Glucan endo-1,3-beta-glucosidase 5 from Arabidopsis with 72% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase 5 from Arabidopsis with 73.44% of identity
• Eggnog: glucan endo-1,3-beta-glucosidase(ENOG410YE7X)
• Kegg: Link to kegg annotations (AT4G31140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447498.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;