Protein coding transcript 167655

• Transcript: Ll_transcript_181093
• CDS coordinates: 1217-1804 (+)
• Peptide sequence: MEVVVVPSLPKQPHLYTAADEVISSLLDLQLEKWGLPPFEDWVEGTLPLDRWYIGGPVVKGFGRGSKVLGIPTANLSTEGYSDLLAEYPAGVYFGWAGLPARGVFKMVMSIGWNPYFNNQEKTIEPWLLHDFNEDFYGEELRLLIVGYIRPEANFPTLESLIAKIHEDRKVAERALDIPMYSSYKNDSYLRSSQE*
• ORF Type: complete

Annotations of Ll_transcript_181093

• Blastp: Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 79.89% of identity
• Blastx: Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 79.5% of identity
• Eggnog: riboflavin biosynthesis protein ribF(COG0196)
• Kegg: Link to kegg annotations (AT4G21470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431913.1)
• Pfam: Riboflavin kinase (PF01687.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;