Protein coding transcript 167669

• Transcript: Ll_transcript_181101
• CDS coordinates: 826-1197 (+)
• Peptide sequence: MEVVVVPSLPKQPHLYTAADEVISSLLDLQLEKWGLPPFEDWVEGTLPLDRWYIGGPVVKGFGRGSKVLGIPTANLSTEGYSDLLAEYPAGVYFGWAGLPARGVFKMVMSIGWNPYFNNQEKTI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_181101

• Blastp: Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 79.67% of identity
• Blastx: Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 56.57% of identity
• Eggnog: riboflavin biosynthesis protein ribF(COG0196)
• Kegg: Link to kegg annotations (AT4G21470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003529296.1)
• Pfam: Riboflavin kinase (PF01687.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;