Protein coding transcript 167676

• Transcript: Ll_transcript_180209
• CDS coordinates: 2-1327 (+)
• Peptide sequence: HARQGAGMLISFLVQGLGVELVPYAPLLVVPLLRCMSDCDRSVRQSVTHSFAALVPLLPLARGLPQPIGLGEGISRNAEDLHFLEQLLDNSHIEDYKLCTELKVTLRRYQQEGINWLAFLKRFKLHGILCDDMGLGKTLQASAIVASDIAEHRTSIGNEDLLPSLIICPSTLVGHWAFEIEKYIDASVISSLQYVGSAQERVFLRDHFCKHNVIITSYDVIRKDIDYLGQLLWKYCILDEGHIIKNAKSKVTLAVKQLKAEHRLILSGTPIQNNIMDLWSLFDFLMPGFLGTERQFQATYGKPLLAARDPKCSAKDAEAGALAMEALHKQVMPFLLRRTKDEVLSDLPEKIIQDRFCDLSAVQLKLYEQYSGSHVKQEVSSIVTTNEPGAAEGSSSSTKASSHVFQAISFLRLSVSYCSIGFFIFCMPINPFLCPRHSNTC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_180209

• Blastp: TATA-binding protein-associated factor BTAF1 from Arabidopsis with 80.39% of identity
• Blastx: TATA-binding protein-associated factor BTAF1 from Arabidopsis with 80.29% of identity
• Eggnog: excision repair cross-complementing rodent repair deficiency complementation group(ENOG410XP4Z)
• Kegg: Link to kegg annotations (AT3G54280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412827.1)
• Pfam: SNF2 family N-terminal domain (PF00176.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;